"action" : "rerender" ] "actions" : [ }, ] }, "context" : "", "context" : "", "action" : "rerender" ] "context" : "envParam:quiltName", "context" : "", }, "event" : "approveMessage", count = 0; "initiatorBinding" : true, { "action" : "rerender" "useCountToKudo" : "false", "event" : "MessagesWidgetEditCommentForm", }, "useCountToKudo" : "false", }); "action" : "rerender" ] "action" : "rerender" { "message" : "2684781", position: absolute; ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", "actions" : [ { } "actions" : [ if ( !watching ) { { font-size: 10px; "revokeMode" : "true", } { "actions" : [ "event" : "MessagesWidgetAnswerForm", { }, { console.log("I AM FORUM MESSAGE") "event" : "MessagesWidgetEditAction", { { { .gk-banner__link { { "action" : "rerender" "action" : "rerender" "action" : "rerender" "action" : "pulsate" ] { { "event" : "removeMessageUserEmailSubscription", }, "event" : "unapproveMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", "action" : "rerender" ] } }); "event" : "RevokeSolutionAction", "action" : "rerender" } }, }, "context" : "", "actions" : [ "context" : "", } "context" : "envParam:quiltName", "actions" : [ { "action" : "rerender" ] "action" : "rerender" "action" : "rerender" { "action" : "rerender" "action" : "rerender" ] ] } "action" : "rerender" } "disableLinks" : "false", }, "action" : "pulsate" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "MessagesWidgetAnswerForm", { "disableLabelLinks" : "false", { "context" : "envParam:quiltName,message", "use strict"; }, "actions" : [ "action" : "rerender" "event" : "unapproveMessage", "context" : "", "event" : "MessagesWidgetEditAnswerForm", { "initiatorBinding" : true, } "context" : "", ] "action" : "pulsate" ] { } .attr('aria-hidden','true') "action" : "rerender" "selector" : "#kudosButtonV2_7", { { { } "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", setWarning(pagerId); { "useTruncatedSubject" : "true", }); { } "disallowZeroCount" : "false", ] { { "context" : "", "eventActions" : [ "action" : "rerender" "action" : "rerender" "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", { }, { { "action" : "rerender" { "event" : "ProductAnswer", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); ] { return; "linkDisabled" : "false" "context" : "", ] { "actions" : [ "action" : "rerender" "event" : "MessagesWidgetCommentForm", ] "truncateBody" : "true", lithstudio: [], { "actions" : [ } })(LITHIUM.jQuery); { "context" : "", { ;(function($) { "parameters" : { "actions" : [ { "actions" : [ ] } { $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2684680 .lia-rating-control-passive', '#form_5'); "event" : "markAsSpamWithoutRedirect", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2684767 .lia-rating-control-passive', '#form_7'); })(LITHIUM.jQuery); "action" : "rerender" { { "event" : "markAsSpamWithoutRedirect", return false; }, "event" : "addMessageUserEmailSubscription", "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); }, "useCountToKudo" : "false", { { }, "event" : "removeMessageUserEmailSubscription", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); } { ;(function($) { }, ] { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "action" : "pulsate" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "quiltName" : "ForumMessage", "actions" : [ ], { ] "action" : "rerender" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); "truncateBodyRetainsHtml" : "false", if (1 != val) "entity" : "2684680", } }, ] ;(function($) { }, "initiatorBinding" : true, }, "action" : "rerender" }); "showCountOnly" : "false", { } "action" : "pulsate" } }, "actions" : [ "context" : "", ] "context" : "", "action" : "rerender" "event" : "unapproveMessage", }, "action" : "rerender" "selector" : "#kudosButtonV2_6", { ] }, "useSubjectIcons" : "true", ] "context" : "envParam:quiltName,product,contextId,contextUrl", ] ] "useTruncatedSubject" : "true", "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,message", }, "disableLinks" : "false", { { { } } "context" : "envParam:quiltName", { "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. })(LITHIUM.jQuery); "showCountOnly" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Ihr Vergleich stimmt nicht. "context" : "envParam:feedbackData", "event" : "kudoEntity", "; "event" : "MessagesWidgetEditAnswerForm", "useSimpleView" : "false", ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "MessagesWidgetEditAnswerForm", { { "actions" : [ "context" : "", "context" : "envParam:quiltName,message", }, "event" : "MessagesWidgetMessageEdit", // enable redirect to login page when "logmein" is typed into the void =) })(LITHIUM.jQuery); }, "context" : "", "event" : "addMessageUserEmailSubscription", "useSimpleView" : "false", { "action" : "rerender" })(LITHIUM.jQuery); ] "action" : "rerender" ] }, }, "context" : "", function disableInput(pagerId) { "initiatorBinding" : true, "action" : "rerender" "action" : "pulsate" "action" : "pulsate" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "event" : "removeThreadUserEmailSubscription", > 0) ) LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); ] } ] "initiatorBinding" : true, } } "actions" : [ "event" : "deleteMessage", "}); ', 'ajax'); })(); "disableKudosForAnonUser" : "false", "event" : "unapproveMessage", "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(this).addClass('active') { "action" : "rerender" $(this).next().toggle(); "revokeMode" : "true", "context" : "envParam:quiltName", }, "event" : "addThreadUserEmailSubscription", } ], "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "", ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '9y9A5uReEOQeWnV5iUfDjvjD2PsbFiWBW4ublf5AtzA. { } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "addClassName" } }, "action" : "rerender" }, } "action" : "rerender" { // just for convenience, you need a login anyways... "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2684693,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ { { ] ] } ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "revokeMode" : "true", } "actions" : [ { "quiltName" : "ForumMessage", "action" : "rerender" }, "actions" : [ } { { { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); }, "actions" : [ "event" : "AcceptSolutionAction", ] { { "actions" : [ } { "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", } { ] "actions" : [ }, { "context" : "", } // We're good so far. { } "action" : "rerender" { else if(pageName === 'community/Page') { })(LITHIUM.jQuery); "revokeMode" : "true", "event" : "ProductAnswerComment", "event" : "QuickReply", "event" : "unapproveMessage", ;(function($) { "useSubjectIcons" : "true", } }, "event" : "MessagesWidgetMessageEdit", "actions" : [ Anmeldung der Internetrufnummer X war nicht erfolg... Ständige Verbindungsabrüche bei Webseite und z.b. } "event" : "kudoEntity", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "actions" : [ "event" : "unapproveMessage", ] }, "actions" : [ "parameters" : { function disableInput(pagerId) { "actions" : [ "action" : "rerender" "action" : "rerender"

Tanz-workout Für übergewichtige, Joghurt Nicht Wärmebehandelt Edeka, My Generation Band Großbottwar, Articles V